Web stats for Rtr - rtr.ua
1.67 Rating by ClearWebStats
This website has a #3,311,150 rank in global traffic. It has a .ua as an domain extension. This domain is estimated value of $ 240.00 and has a daily earning of $ 1.00. While no active threats were reported recently by users, rtr.ua is SAFE to browse.
Traffic Report of Rtr
Daily Unique Visitors: | 145 |
Daily Pageviews: | 290 |
Estimated Valuation
Income Per Day: | $ 1.00 |
Estimated Worth: | $ 240.00 |
Search Engine Indexes
Google Indexed Pages: | Not Applicable |
Yahoo Indexed Pages: | Not Applicable |
Bing Indexed Pages: | Not Applicable |
Search Engine Backlinks
Google Backlinks: | Not Applicable |
Bing Backlinks: | Not Applicable |
Alexa BackLinks: | Not Applicable |
Safety Information
Google Safe Browsing: | No Risk Issues |
Siteadvisor Rating: | Not Applicable |
WOT Trustworthiness: | Good |
WOT Privacy: | Good |
WOT Child Safety: | Excellent |
Website Ranks & Scores
Google Pagerank: | Not Applicable |
Alexa Rank: | 3,311,150 |
Domain Authority: | Not Applicable |
Google Pagerank
PR 0 out of 10
PageSpeed Score
100
Siteadvisor Rating
Not Applicable
Where is rtr.ua server located?
Social Engagement
Facebook Shares: | Not Applicable |
Facebook Likes: | Not Applicable |
Facebook Comments: | Not Applicable |
Twitter Count (Tweets): | Not Applicable |
Linkedin Shares: | Not Applicable |
Delicious Shares: | Not Applicable |
Page Resources Breakdown
Homepage Links Analysis
Website Inpage Analysis
H1 Headings: | Not Applicable | H2 Headings: | Not Applicable |
H3 Headings: | Not Applicable | H4 Headings: | Not Applicable |
H5 Headings: | Not Applicable | H6 Headings: | Not Applicable |
Total IFRAMEs: | Not Applicable | Total Images: | Not Applicable |
Google Adsense: | Not Applicable | Google Analytics: | Not Applicable |
HTTP Header Analysis
Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Fri, 08 Jul 2016 16:31:06 GMT
Server: Apache/2.2.15 (CentOS)
Last-Modified: Sun, 27 Dec 2015 08:52:13 GMT
ETag: "25707-12b-527dd4df96940"
Accept-Ranges: bytes
Content-Length: 299
Connection: close
Content-Type: text/html; charset=UTF-8
Status-Code: 200
Status: 200 OK
Date: Fri, 08 Jul 2016 16:31:06 GMT
Server: Apache/2.2.15 (CentOS)
Last-Modified: Sun, 27 Dec 2015 08:52:13 GMT
ETag: "25707-12b-527dd4df96940"
Accept-Ranges: bytes
Content-Length: 299
Connection: close
Content-Type: text/html; charset=UTF-8
Domain Nameserver Information
DNS Record Analysis
Host | Type | TTL | Extra |
---|---|---|---|
rtr.ua | A | 900 |
IP:91.222.138.101 |
rtr.ua | NS | 897 |
Target:ns3.fastdns.hosting |
rtr.ua | NS | 897 |
Target:ns1.fastdns.hosting |
rtr.ua | NS | 897 |
Target:ns2.fastdns.hosting |
rtr.ua | SOA | 900 |
MNAME:ns1.fastdns.hosting RNAME:hostmaster.adm.tools Serial:2016070311 Refresh:43200 Retry:7200 Expire:604800 |
rtr.ua | MX | 900 |
Priority:10 Target:mx.yandex.net |
Similarly Ranked Websites to Rtr
Most famous paintings and most popular painters of all time
- allpaintingsstore.com
Allpaintingsstore.com is a perfect place for art-lovers all over the world. Allpaintingsstore has gathered the best famous paintings of all times just for you!
Tours to Poland 2014 | Greetings from Poland!Greetings from Poland! | Incoming travel services by GFPTravel
- greetingsfrompoland.com
Tours to Poland 2014 - largest selection of offers for your tours to Poland 2014. Come to Poland and visit our beautiful country. GFP Travel is a licensed.
The Original Smoothie Bombs™ – The Smoothie Bombs
- thesmoothiebombs.com
pre-portioned smoothie boosters
Palm Springs Hotel | 7 Springs Hotel
- palm-springs-hotels.cc
Palm Springs hotel the 7 Springs offers amazing accommodations and service that you want in a hotel in Palm Springs.
Happy Independence Day 2020
- independentdaygift.pinkvillapro.com
Create Happy Independence Day Wishes, 15 August 2020, Happy Independence Day 2020 wishing website
Full WHOIS Lookup for rtr.ua
% request from 199.193.119.77
% This is the Ukrainian Whois query server #I.
% The Whois is subject to Terms of use
% See https://hostmaster.ua/services/
%
domain: rtr.ua
dom-public: NO
license: 163404
registrant: imena-2852970
admin-c: imena-2852971
tech-c: imena-2852973
mnt-by: ua.imena
nserver: ns3.fastdns.hosting
nserver: ns2.fastdns.hosting
nserver: ns1.fastdns.hosting
status: ok
created: 2013-03-15 16:40:26+02
modified: 2016-06-11 17:19:26+03
expires: 2017-03-15 16:40:26+02
source: UAEPP
% Registrar:
% ==========
registrar: ua.imena
organization: Internet Invest Ltd
organization-loc: ТОВ "Інтернет Інвест"
url: http://www.imena.ua
city: Kyiv
country: UA
source: UAEPP
% Registrant:
% ===========
contact-id: imena-2852970
person: not published
person-loc: not published
e-mail: not published
address: n/a
address-loc: not published
phone: not published
mnt-by: ua.imena
status: ok
status: linked
created: 2014-04-03 05:48:26+03
source: UAEPP
% Administrative Contacts:
% =======================
contact-id: imena-2852971
person: not published
person-loc: not published
e-mail: not published
address: n/a
address-loc: not published
phone: not published
mnt-by: ua.imena
status: ok
status: linked
created: 2014-04-03 05:48:27+03
source: UAEPP
% Technical Contacts:
% ===================
contact-id: imena-2852973
person: not published
person-loc: not published
e-mail: not published
address: n/a
address-loc: not published
phone: not published
mnt-by: ua.imena
status: ok
status: linked
created: 2014-04-03 05:48:28+03
source: UAEPP
% Query time: 46 msec
% This is the Ukrainian Whois query server #I.
% The Whois is subject to Terms of use
% See https://hostmaster.ua/services/
%
domain: rtr.ua
dom-public: NO
license: 163404
registrant: imena-2852970
admin-c: imena-2852971
tech-c: imena-2852973
mnt-by: ua.imena
nserver: ns3.fastdns.hosting
nserver: ns2.fastdns.hosting
nserver: ns1.fastdns.hosting
status: ok
created: 2013-03-15 16:40:26+02
modified: 2016-06-11 17:19:26+03
expires: 2017-03-15 16:40:26+02
source: UAEPP
% Registrar:
% ==========
registrar: ua.imena
organization: Internet Invest Ltd
organization-loc: ТОВ "Інтернет Інвест"
url: http://www.imena.ua
city: Kyiv
country: UA
source: UAEPP
% Registrant:
% ===========
contact-id: imena-2852970
person: not published
person-loc: not published
e-mail: not published
address: n/a
address-loc: not published
phone: not published
mnt-by: ua.imena
status: ok
status: linked
created: 2014-04-03 05:48:26+03
source: UAEPP
% Administrative Contacts:
% =======================
contact-id: imena-2852971
person: not published
person-loc: not published
e-mail: not published
address: n/a
address-loc: not published
phone: not published
mnt-by: ua.imena
status: ok
status: linked
created: 2014-04-03 05:48:27+03
source: UAEPP
% Technical Contacts:
% ===================
contact-id: imena-2852973
person: not published
person-loc: not published
e-mail: not published
address: n/a
address-loc: not published
phone: not published
mnt-by: ua.imena
status: ok
status: linked
created: 2014-04-03 05:48:28+03
source: UAEPP
% Query time: 46 msec