1.67 Rating by ClearWebStats
This website has a #3,311,150 rank in global traffic. It has a .ua as an domain extension. This domain is estimated value of $ 240.00 and has a daily earning of $ 1.00. While no active threats were reported recently by users, rtr.ua is SAFE to browse.
Get Custom Widget

Traffic Report of Rtr

Daily Unique Visitors: 145
Daily Pageviews: 290

Estimated Valuation

Income Per Day: $ 1.00
Estimated Worth: $ 240.00

Search Engine Indexes

Google Indexed Pages: Not Applicable
Yahoo Indexed Pages: Not Applicable
Bing Indexed Pages: Not Applicable

Search Engine Backlinks

Google Backlinks: Not Applicable
Bing Backlinks: Not Applicable
Alexa BackLinks: Not Applicable

Safety Information

Google Safe Browsing: No Risk Issues
Siteadvisor Rating: Not Applicable
WOT Trustworthiness: WOT Trust rank for rtr.ua Good
WOT Privacy: WOT privacy rank for rtr.ua Good
WOT Child Safety: WOT child safety rank for rtr.ua Excellent

Website Ranks & Scores

Google Pagerank: Not Applicable
Alexa Rank: 3,311,150
Domain Authority: Not Applicable
Google Pagerank
PR 0 out of 10
PageSpeed Score
100
Siteadvisor Rating
View rtr.ua site advisor rating Not Applicable

Where is rtr.ua server located?

Hosted IP Address:

91.222.138.101 View other site hosted with rtr.ua

Hosted Country:

rtr.ua hosted country UA rtr.ua hosted country

Location Latitude:

50.4547

Location Longitude:

30.5238

Social Engagement

Facebook Shares: Not Applicable
Facebook Likes: Not Applicable
Facebook Comments: Not Applicable
Twitter Count (Tweets): Not Applicable
Linkedin Shares: Not Applicable
Delicious Shares: Not Applicable

Page Resources Breakdown

View rtr.ua HTML resources

Homepage Links Analysis

autoslog.com

Website Inpage Analysis

H1 Headings: Not Applicable H2 Headings: Not Applicable
H3 Headings: Not Applicable H4 Headings: Not Applicable
H5 Headings: Not Applicable H6 Headings: Not Applicable
Total IFRAMEs: Not Applicable Total Images: Not Applicable
Google Adsense: Not Applicable Google Analytics: Not Applicable

HTTP Header Analysis

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Fri, 08 Jul 2016 16:31:06 GMT
Server: Apache/2.2.15 (CentOS)
Last-Modified: Sun, 27 Dec 2015 08:52:13 GMT
ETag: "25707-12b-527dd4df96940"
Accept-Ranges: bytes
Content-Length: 299
Connection: close
Content-Type: text/html; charset=UTF-8

Domain Nameserver Information

Host IP Address Country
ns3.fastdns.hosting rtr.ua name server information 195.154.34.21 rtr.ua server is located in France France
ns1.fastdns.hosting rtr.ua name server information 91.222.136.45 rtr.ua server is located in Ukraine Ukraine
ns2.fastdns.hosting rtr.ua name server information 91.206.200.105 rtr.ua server is located in Ukraine Ukraine

DNS Record Analysis

Host Type TTL Extra
rtr.ua A 900 IP:91.222.138.101
rtr.ua NS 897 Target:ns3.fastdns.hosting
rtr.ua NS 897 Target:ns1.fastdns.hosting
rtr.ua NS 897 Target:ns2.fastdns.hosting
rtr.ua SOA 900 MNAME:ns1.fastdns.hosting
RNAME:hostmaster.adm.tools
Serial:2016070311
Refresh:43200
Retry:7200
Expire:604800
rtr.ua MX 900 Priority:10
Target:mx.yandex.net

Similarly Ranked Websites to Rtr

Most famous paintings and most popular painters of all time

rtr.ua favicon - allpaintingsstore.com

Allpaintingsstore.com is a perfect place for art-lovers all over the world. Allpaintingsstore has gathered the best famous paintings of all times just for you!

View rtr.ua Pagerank   Alexa rank for rtr.ua 3,311,155   website value of rtr.ua $ 240.00

Tours to Poland 2014 | Greetings from Poland!Greetings from Poland! | Incoming travel services by GFPTravel

rtr.ua favicon - greetingsfrompoland.com

Tours to Poland 2014 - largest selection of offers for your tours to Poland 2014. Come to Poland and visit our beautiful country. GFP Travel is a licensed.

View rtr.ua Pagerank   Alexa rank for rtr.ua 3,311,158   website value of rtr.ua $ 240.00

The Original Smoothie Bombs™ – The Smoothie Bombs

rtr.ua favicon - thesmoothiebombs.com

pre-portioned smoothie boosters

View rtr.ua Pagerank   Alexa rank for rtr.ua 3,311,166   website value of rtr.ua $ 240.00

Palm Springs Hotel | 7 Springs Hotel

rtr.ua favicon - palm-springs-hotels.cc

Palm Springs hotel the 7 Springs offers amazing accommodations and service that you want in a hotel in Palm Springs.

View rtr.ua Pagerank   Alexa rank for rtr.ua 3,311,170   website value of rtr.ua $ 240.00

Happy Independence Day 2020

rtr.ua favicon - independentdaygift.pinkvillapro.com

Create Happy Independence Day Wishes, 15 August 2020, Happy Independence Day 2020 wishing website

View rtr.ua Pagerank   Alexa rank for rtr.ua 3,311,173   website value of rtr.ua $ 240.00

Full WHOIS Lookup for rtr.ua

% request from 199.193.119.77
% This is the Ukrainian Whois query server #I.
% The Whois is subject to Terms of use
% See https://hostmaster.ua/services/
%

domain: rtr.ua
dom-public: NO
license: 163404
registrant: imena-2852970
admin-c: imena-2852971
tech-c: imena-2852973
mnt-by: ua.imena
nserver: ns3.fastdns.hosting
nserver: ns2.fastdns.hosting
nserver: ns1.fastdns.hosting
status: ok
created: 2013-03-15 16:40:26+02
modified: 2016-06-11 17:19:26+03
expires: 2017-03-15 16:40:26+02
source: UAEPP

% Registrar:
% ==========
registrar: ua.imena
organization: Internet Invest Ltd
organization-loc: ТОВ "Інтернет Інвест"
url: http://www.imena.ua
city: Kyiv
country: UA
source: UAEPP

% Registrant:
% ===========
contact-id: imena-2852970
person: not published
person-loc: not published
e-mail: not published
address: n/a
address-loc: not published
phone: not published
mnt-by: ua.imena
status: ok
status: linked
created: 2014-04-03 05:48:26+03
source: UAEPP

% Administrative Contacts:
% =======================
contact-id: imena-2852971
person: not published
person-loc: not published
e-mail: not published
address: n/a
address-loc: not published
phone: not published
mnt-by: ua.imena
status: ok
status: linked
created: 2014-04-03 05:48:27+03
source: UAEPP

% Technical Contacts:
% ===================
contact-id: imena-2852973
person: not published
person-loc: not published
e-mail: not published
address: n/a
address-loc: not published
phone: not published
mnt-by: ua.imena
status: ok
status: linked
created: 2014-04-03 05:48:28+03
source: UAEPP


% Query time: 46 msec